2024 Sp p00360.3 g3p1

Sp p00360.3 g3p1_yeast

Author: xnak

August undefined, 2024

WebNumerical results for UniProtKB/Swiss-Prot release 2024_05 which contains 568'744 sequence entries. Weband tetrads in budding yeast Ravinder Kumar and Sanjeeva Srivastava* Department of Biosciences and Bioengineering, Indian Institute of Technology Bombay, Powai, Mumbai-400076, India * Correspondence author: Dr. Sanjeeva Srivastava, Department of Biosciences and Bioengineering, IIT Bombay,

Entry: - ExPASy - PROSITE

WebP00360 / G3P1_YEAST: Protein Name : Glyceraldehyde-3-phosphate dehydrogenase 1: Gene Name : Name: TDH1 … Webarx1_yeast p38011 gblp_yeast q08004 bud20_yeast p38779 cic1_yeast p24784 dbp1_yeast p24783 dbp2_yeast p06634 ded1_yeast p32324 ef2_yeast a6zwl1 nacb1_yeas7 a6zt99 naca_yeas7 p07149 fas1_yeast p19097 gay rights summit

www.researchgate.net

WebID 1.2.1.12 DE glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). AN GAPDH. AN NAD-dependent glyceraldehyde-3-phosphate dehydrogenase. WebP78958 · G3P1_SCHPO. Protein. Glyceraldehyde-3-phosphate dehydrogenase 1 ... Glyceraldehyde-3-phosphate dehydrogenase 1. EC number. EC:1.2.1.12 ... ORF names. SPBC32F12.11. Organism names. Organism. Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Taxonomic identifier. 284812 NCBI. Taxonomic lineage. … http://moondb.hb.univ-amu.fr/protein/P00360 days after period ovulation

Supplemental Material to

WebHandle yeast in a suspension form; use non-latex disposable gloves Seek medical assistance Method 1. Set up five water baths of varying temperatures: 20, 30, 40, 50 and … WebP00360 · G3P1_YEAST. Glyceraldehyde-3-phosphate dehydrogenase 1 · Gene: TDH1 (GPD1, ... GLC5) · Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) · EC:3.6.5.2 · 322 amino acids · Evidence at protein level · Annotation score: 5/5. #Hydrolase. 7 PTMs 4 interactions 23 reviewed publications. gay rights speechWebP78958 · G3P1_SCHPO. Protein. Glyceraldehyde-3-phosphate dehydrogenase 1 ... Glyceraldehyde-3-phosphate dehydrogenase 1. EC number. EC:1.2.1.12 ... ORF names. … days after pollination

"WebID GAPDH; PATTERN. AC PS00071; DT 01-APR-1990 CREATED; 01-DEC-2004 DATA UPDATE; 25-MAY-2024 INFO UPDATE. DE Glyceraldehyde 3-phosphate dehydrogenase active site. PA [ASV]-S-C-[NT] " - Sp p00360.3 g3p1_yeast

Sp p00360.3 g3p1_yeast

Web2 Jan 2012 · glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) Other names: 3-phosphoglyceraldehyde dehydrogenase. NAD-dependent glyceraldehyde phosphate … Web{"ymdb_id":"YMDB00672","created_at":"2011-05-29T18:42:16.000Z","updated_at":"2016-09-08T18:35:45.000Z","name":"3-phospho-D-glyceroyl dihydrogen phosphate","cas ...

Did you know?

Webref NP_012483.3 glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) TDH1 [Saccharomyces cerevisiae S288c] sp P00360.3 G3P1_YEAST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1 ...

WebVPS21_YEAST — P36017 — Saccharomyces cerevisiae S288c. See all my interactions using search with filters. Temporarily not available for viewing in Netility. View the details of my gene in DAnCER. http://www.bioinfo.cnio.es/Cursos/embrace_EBI/treedet_files/PF02800.mfa

Webgb AEQ53933.1 14-3-3 protein [Triticum aestivum] gb AFL70188.1 14-3-3 protein [Triticum aestivum] contig15110 gb EMS50339.1 hypothetical protein TRIUR3_18239 [Triticum urartu] contig23666 ref XP_003571990.1 PREDICTED: phospholipase D beta 1-like [Brachypodium distachyon] contig93695 gb ABX76295.1 neutral ceramidase [Triticum aestivum] Web>P22512+3=G3PG_TRYBB/171-333 LAPLVHVLVKEGFGISTGLMTTVHSYTATQKTVDGVSV-KDWRGGRAAALNIIPSTTGAAKAVGMVIPSTQGKLTGMAFR VPTADVSVVDLTFIATRD-TSIKEIDAALKRASK ...

WebRecombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) TDH1 protein. Validations. None available. Applications. Enzyme-linked immunosorbent assay …

Web23 Jan 2007 · Function. Catalyzes the oxidative phosphorylation of glyceraldehyde 3-phosphate (G3P) to 1,3-bisphosphoglycerate (BPG) using the cofactor NAD. The first reaction step involves the formation of a hemiacetal intermediate between G3P and a cysteine residue, and this hemiacetal intermediate is then oxidized to a thioester, with … gay rights shirtWebP00360 · G3P1_YEAST Glyceraldehyde-3-phosphate dehydrogenase 1 · Gene: TDH1 (GPD1, SSS2) · Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) · … gay rights stickersWebG3P1_YEAST: Nice View - a user-friendly view of this entry ID G3P1_YEAST; STANDARD; 2DG. AC P00360; DT 01-AUG-1995, integrated into SWISS-2DPAGE (release 2). DT 01-OCT … gay rights portugalhttp://www.wodaklab.org/iRefWeb/interactor/show/16830189 days after plantingWebP00360 (G3P1_YEAST) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Glyceraldehyde-3-phosphate dehydrogenase 1 UniProtKB InterPro STRING … days after zombie survival mod apkWeb* G3P1_YEAST * accession n°: P00360 Identification Methods: * MAPPING: {Mi} SWISS-2DPAGE Viewer YEAST { Saccharomyces cerevisiae } (AC: P00360) Back to the search engine: Switch to Gel: Re-scale Gel from 100% to: View: Display: Identified spots Identification details: show hide details: PMF Tandem ... gay rights statisticsWebGlyceraldehyde-3-phosphate dehydrogenase 1: Synonyms: GAPDH 1; Gene Name: TDH1 : Enzyme Class: 1.2.1.12 ; Biological Properties; General Function: Involved in … days after sowing